Pancrelipase amylase
识别
- 总结
-
Pancrelipase amylaseis a lipase used to treat pancreatic exocrine insufficiency.
- Brand Names
-
Cotazym, Creon, Pancrease MT, Pancreaze, Pertzye, Viokace, Zenpep
- Generic Name
- Pancrelipase amylase
- DrugBank Accession Number
- DB11065
- Background
-
Pancrelipase, in general, is composed of a mixture of pancreatic enzymes which include amylases, lipases, and proteases. These enzymes are extracted from porcine pancreatic glands.4The amylases are enzymes that help in the chemical process of digestion by hydrolizing starch into more available saccharide forms.3The pancrelipase amylase is a single polypeptide chain containing two SH groups and four disulfide bridges.6The pancrelipase mixture, including pancrelipase amylase, was developed by Ortho-McNeil-Janssen Pharmaceuticals, Inc and FDA approved on April 12, 2010.5
- Type
- Biotech
- Groups
- Approved
- Biologic Classification
-
Protein Based Therapies
Other protein based therapies - Protein Structure
- Protein Chemical Formula
- Not Available
- Protein Average Weight
- 57086.0 Da
- Sequences
-
>sp|P00690|AMYP_PIG Pancreatic alpha-amylase OS=Sus scrofa OX=9823 GN=AMY2 PE=1 SV=3 MKLFLLLSAFGFCWAQYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPP NENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGS GAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGL LDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAG SRPFIFQEVIDLGGEAIQSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWG FMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWA RNFVNGQDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWRQIRNMVWFRNVVDGQP FANWWANGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGI KVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Download FASTA Format - Synonyms
-
- 1,4-alpha-D-Glucan glucanohydrolase
- alpha-Amylase
- alpha-amylase (porcine)
- Alpha-amylase swine pancreas
- alpha-Amylases
- Amylase A
- Amylase AD
- Amylase, pancreatic
- Porcine pancreas alpha-amylase
Pharmacology
- Indication
-
Please refer toPancrelipase.
Reduce drug development failure ratesBuild, train, & validate machine-learning models
with evidence-based and structured datasets.Build, train, & validate predictive machine-learning models with structured datasets. - Associated Conditions
- Contraindications & Blackbox Warnings
-
Avoid life-threatening adverse drug eventsImprove clinical decision support with information oncontraindications & blackbox warnings, population restrictions, harmful risks, & more.Avoid life-threatening adverse drug events & improve clinical decision support.
- Pharmacodynamics
-
Please refer toPancrelipase.
- Mechanism of action
-
The pancrelipase amylase acts by replacing the lack of physiological amylase. The amylase activity is done by the hydrolyzation of the alpha 1-4 linkages in the polysaccharides of three or more linked glucose units. The linkages alpha 1-6 are not hydrolyzed and thus, the starch is only reduced to lower molecule compounds.6
Target Actions Organism ADietary starch cleavageHumans - Absorption
-
Please refer toPancrelipase.
- Volume of distribution
-
Please refer toPancrelipase.
- Protein binding
-
Please refer toPancrelipase.
- Metabolism
-
Please refer toPancrelipase.
- Route of elimination
-
Please refer toPancrelipase.
- Half-life
-
Please refer toPancrelipase.
- Clearance
-
Please refer toPancrelipase.
- Adverse Effects
-
Improve decision support & research outcomesWith structured adverse effects data, including:blackbox warnings, adverse reactions, warning & precautions, & incidence rates.Improve decision support & research outcomes with our structured adverse effects data.
- Toxicity
-
Please refer toPancrelipase.
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRsBrowse all" title="" id="snp-actions-info" class="drug-info-popup" href="javascript:void(0);">
- Not Available
Interactions
- Drug InteractionsLearn More" title="" id="structured-interactions-info" class="drug-info-popup" href="javascript:void(0);">
-
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.Not Available
- Food Interactions
-
- Take with food.
Products
-
Drug product information from 10+ global regions我们的数据集公关ovide approved product information including:
dosage, form, labeller, route of administration, and marketing period.Access drug product information from over 10 global regions. - Product Images
-
- Mixture Products
-
Name Ingredients Dosage Route Labeller Marketing Start Marketing End Region Image Chewable Enzymes Tablets Pancrelipase amylase(5 mg)+Bromelains(15 mg)+Papain(100 mg) Tablet Oral Gahler Enterprises Ltd. 1988-12-31 2002-07-17 Canada Cotazym Pancrelipase amylase(40000 units)+Pancrelipase lipase(10000 units)+Pancrelipase protease(35000 units) Capsule Oral Organon Canada Inc. 1973-12-31 Not applicable Canada CotazymEcs 20 Pancrelipase amylase(100000 units)+Pancrelipase lipase(25000 units)+Pancrelipase protease(100000 units) Capsule, delayed release Oral Organon Canada Inc. 1989-12-31 Not applicable Canada CotazymEcs 4 Pancrelipase amylase(11000 unit)+Pancrelipase lipase(4000 unit)+Pancrelipase protease(11000 unit) Capsule Oral Merck Ltd. 1997-08-18 2012-01-23 Canada CotazymEcs 8 Pancrelipase amylase(42000 units)+Pancrelipase lipase(10800 units)+Pancrelipase protease(45000 units) Capsule, delayed release Oral Organon Canada Inc. 1980-12-31 Not applicable Canada Creon Pancrelipase amylase(15000 [USP'U]/1)+Pancrelipase lipase(3000 [USP'U]/1)+Pancrelipase protease(9500 [USP'U]/1) Capsule, delayed release Oral AbbVie Inc. 2009-04-30 Not applicable US Creon Pancrelipase amylase(60000 [USP'U]/1)+Pancrelipase lipase(12000 [USP'U]/1)+Pancrelipase protease(38000 [USP'U]/1) Capsule, delayed release pellets Oral Physicians Total Care, Inc. 2009-09-29 Not applicable US Creon Pancrelipase amylase(30000 [USP'U]/1)+Pancrelipase lipase(6000 [USP'U]/1)+Pancrelipase protease(19000 [USP'U]/1) Capsule, delayed release pellets Oral AbbVie Inc. 2009-04-30 Not applicable US Creon Pancrelipase amylase(120000 [USP'U]/1)+Pancrelipase lipase(24000 [USP'U]/1)+Pancrelipase protease(76000 [USP'U]/1) Capsule, delayed release pellets Oral AbbVie Inc. 2009-04-30 Not applicable US Creon Pancrelipase amylase(60000 [USP'U]/1)+Pancrelipase lipase(12000 [USP'U]/1)+Pancrelipase protease(38000 [USP'U]/1) Capsule, delayed release pellets Oral Atlantic Biologicals Corps. 2010-08-13 Not applicable US - Unapproved/Other Products
-
Name Ingredients Dosage Route Labeller Marketing Start Marketing End Region Image Creon 10 Minimicrospheres Pancrelipase amylase(33200 [USP'U]/1)+Pancrelipase lipase(10000 [USP'U]/1)+Pancrelipase protease(37500 [USP'U]/1) Capsule, delayed release Oral Physicians Total Care, Inc. 2006-09-12 2009-09-30 US Creon 20 Minimicrospheres Pancrelipase amylase(66400 [USP'U]/1)+Pancrelipase lipase(20000 [USP'U]/1)+Pancrelipase protease(75000 [USP'U]/1) Capsule, delayed release Oral Physicians Total Care, Inc. 1995-01-17 2009-09-30 US Pancrelipase Pancrelipase amylase(56000 [USP'U]/1)+Pancrelipase lipase(20000 [USP'U]/1)+Pancrelipase protease(44000 [USP'U]/1) Capsule, delayed release Oral Kaiser Foundations Hospitals 2010-02-01 2010-12-31 US
Categories
- Drug Categories
- Chemical TaxonomyProvided byClassyfire
-
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- 外部描述符
- Not Available
- Affected organisms
-
- Humans and other mammals
Chemical Identifiers
- UNII
- YOJ58O116E
- CAS number
- 9000-90-2
参考文献
- 一般References
-
- Nakajima K, Oshida H, Muneyuki T, Kakei M: Pancrelipase: an evidence-based review of its use for treating pancreatic exocrine insufficiency. Core Evid. 2012;7:77-91. doi: 10.2147/CE.S26705. Epub 2012 Jul 19. [Article]
- Dominguez Munoz JE: Diagnosis of chronic pancreatitis: Functional testing. Best Pract Res Clin Gastroenterol. 2010 Jun;24(3):233-41. doi: 10.1016/j.bpg.2010.03.008. [Article]
- Silverman R. (2002). The organic chemistry of enzyme-catalyzed reactions. Academic Press.
- Creon monograph [Link]
- FDA approval [Link]
- Amylase product information [Link]
- FDA reports [Link]
- CENTER FOR DRUG EVALUATION AND RESEARCH- 20755 [Link]
- EMA reports [Link]
- INVIMA Product Authorization: Panzytrat (pancreatic lipase/amylase/protease) gastroresistant tablets [Link]
- TITCK Product Information: Fermento (pancreatic lipase/amylase/protease with dimethicone) oral capsules [Link]
- External Links
- FDA label
-
Download (483 KB)
- MSDS
-
Download (274 KB)
Clinical Trials
- Clinical TrialsLearn More" title="" id="clinical-trials-info" class="drug-info-popup" href="javascript:void(0);">
-
Phase Status Purpose Conditions Count 4 Active Not Recruiting 治疗 Cystic Fibrosis (CF)/Pancreatitis, Chronic 1 4 Completed 治疗 Cystic Fibrosis (CF) 1 4 Completed 治疗 Cystic Fibrosis (CF)/Exocrine Pancreatic Insufficiency 2 4 Completed 治疗 Pancreatic Insufficiency 1 4 Completed 治疗 Pancreatitis, Chronic 1 4 Terminated 治疗 Exocrine Pancreatic Insufficiency 1 4 Terminated 治疗 Patients With Coeliac Disease and Chronic Diarrhoea (>3 Loose/ Liquid Motions a Day for More Than 4 Weeks)/Patients With Pancreatic Exocrine Insufficiency 1 4 Withdrawn 治疗 Exocrine Pancreatic Insufficiency 1 4 Withdrawn 治疗 Exocrine Pancreatic Insufficiency in Subjects With Diabetes Mellitus Type 2 1 3 Completed 治疗 Cystic Fibrosis (CF)/Exocrine Pancreatic Insufficiency 1
Pharmacoeconomics
- Manufacturers
-
Not Available
- Packagers
-
Not Available
- Dosage Forms
-
Form Route Strength Capsule, delayed release pellets Oral Capsule, delayed release Oral Capsule, delayed release pellets Not applicable Capsule, delayed release pellets Granule, delayed release Oral Capsule Oral Tablet, coated Oral Capsule, coated pellets Oral Capsule, extended release Oral Capsule, coated Oral 22500 U Ph.Eu Tablet Oral Powder Oral - Prices
- Not Available
- Patents
-
Patent Number Pediatric Extension Approved Expires (estimated) Region US9198871 No 2015-12-01 2030-02-07 US US8562979 No 2013-10-22 2028-02-20 US US8562980 No 2013-10-22 2028-02-20 US US8562981 No 2013-10-22 2028-02-20 US US8221747 No 2012-07-17 2028-02-20 US US8562978 No 2013-10-22 2028-02-20 US US8246950 No 2012-08-21 2028-02-20 US US7658918 No 2010-02-09 2028-02-20 US
Properties
- State
- Solid
- Experimental Properties
-
Property Value Source water solubility 1 mg/ml Monograph isoelectric point 5.25-5.95 Pasero L. et al. 1979. HAL archives ouvertes
Targets
insights and accelerate drug research.
参考文献
- Amylase product information [Link]
Drug created at December 03, 2015 16:51 / Updated at May 21, 2021 10:21