Pancrelipase lipase
Identification
- 总结
-
Pancrelipase lipaseis a lipase used to treat pancreatic exocrine insufficiency.
- Brand Names
-
Cotazym, Creon, Pancrease MT, Pancreaze, Pertzye, Viokace, Zenpep
- Generic Name
- Pancrelipase lipase
- DrugBank Accession Number
- DB13147
- Background
-
Pancrelipase, in general, is composed of a mixture of pancreatic enzymes which include amylases, lipases, and proteases. These enzymes are extracted from porcine pancreatic glands.3The pancrelipase lipase is an enzyme secreted by the pancreas that is responsible for the hydrolysis of dietary fat molecules in the human digestive system.1The pancrelipase mixture, including pancrelipase lipase, was developed by Ortho-McNeil-Janssen Pharmaceuticals, Inc and FDA approved on April 12, 2010.4
- Type
- Biotech
- Groups
- Approved
- Biologic Classification
-
Protein Based Therapies
Other protein based therapies - Protein Structure
- Protein Chemical Formula
- Not Available
- Protein Average Weight
- 48000.0 Da
- Sequences
-
>sp|P00591|LIPP_PIG Pancreatic triacylglycerol lipase OS=Sus scrofa OX=9823 GN=PNLIP PE=1 SV=2 SEVCFPRLGCFSDDAPWAGIVQRPLKILPWSPKDVDTRFLLYTNQNQNNYQELVADPSTI TNSNFRMDRKTRFIIHGFIDKGEEDWLSNICKNLFKVESVNCICVDWKGGSRTGYTQASQ NIRIVGAEVAYFVEVLKSSLGYSPSNVHVIGHSLGSHAAGEAGRRTNGTIERITGLDPAE PCFQGTPELVRLDPSDAKFVDVIHTDAAPIIPNLGFGMSQTVGHLDFFPNGGKQMPGCQK NILSQIVDIDGIWEGTRDFVACNHLRSYKYYADSILNPDGFAGFPCDSYNVFTANKCFPC PSEGCPQMGHYADRFPGKTNGVSQVFYLNTGDASNFARWRYKVSVTLSGKKVTGHILVSL FGNEGNSRQYEIYKGTLQPDNTHSDEFDSDVEVGDLQKVKFIWYNNNVINPTLPRVGASK ITVERNDGKVYDFCSQETVREEVLLTLNPC
>sp|P02703|COL_PIG Colipase OS=Sus scrofa OX=9823 GN=CLPS PE=1 SV=3 MEKVLALLLVTLTVAYAVPDPRGIIINLDEGELCLNSAQCKSNCCQHDTILSLSRCALKA RENSECSAFTLYGVYYKCPCERGLTCEGDKSLVGSITNTNFGICHDVGRSSD
Download FASTA Format - Synonyms
-
- Lipase, pancreatic
- Pancreatic lipase
Pharmacology
- Indication
-
Please refer toPancrelipase.
Reduce drug development failure ratesBuild, train, & validate machine-learning models
with evidence-based and structured datasets.Build, train, & validate predictive machine-learning models with structured datasets. - Associated Conditions
- Associated Therapies
- Contraindications & Blackbox Warnings
-
Avoid life-threatening adverse drug eventsImprove clinical decision support with information oncontraindications & blackbox warnings, population restrictions, harmful risks, & more.Avoid life-threatening adverse drug events & improve clinical decision support.
- Pharmacodynamics
-
Please refer toPancrelipase.
- Mechanism of action
-
Pancrelipase lipase catalyzes the hydrolysis of triglycerides to monoglycerides, glycerol, and fatty acids. This activity is performed by the hydrolyzation of the esters of fatty acids. The hydrolysis is started by the action of colipase which helps to anchor lipase to the lipid-water membrane of the micelle producing a surface change on lipase. The hydrophobic active site is exposed for the binding of triglycerides and further interaction with the catalytic triad. In this triad, the function of the three amino acids allows the formation of a deprotonated serine which becomes a nucleophile and act on the ester carbonyl of the fatty acids for the later formation of monoglyceride and fatty acid monomers.2
Target Actions Organism ADietary fat cleavageHumans - Absorption
-
Please refer toPancrelipase.
- Volume of distribution
-
Please refer toPancrelipase.
- Protein binding
-
Please refer toPancrelipase.
- Metabolism
-
Please refer toPancrelipase.
- Route of elimination
-
Please refer toPancrelipase.
- Half-life
-
Please refer toPancrelipase.
- Clearance
-
Please refer toPancrelipase.
- Adverse Effects
-
Improve decision support & research outcomesWith structured adverse effects data, including:blackbox warnings, adverse reactions, warning & precautions, & incidence rates.Improve decision support & research outcomes with our structured adverse effects data.
- Toxicity
-
Please refer toPancrelipase.
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRsBrowse all" title="" id="snp-actions-info" class="drug-info-popup" href="javascript:void(0);">
- Not Available
的相互作用
- Drug InteractionsLearn More" title="" id="structured-interactions-info" class="drug-info-popup" href="javascript:void(0);">
-
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.Not Available
- Food Interactions
-
- Take with food.
Products
-
Drug product information from 10+ global regionsOur datasets provide approved product information including:
dosage, form, labeller, route of administration, and marketing period.Access drug product information from over 10 global regions. - Product Images
-
- Over the Counter Products
-
Name Dosage Strength Route Labeller Marketing Start Marketing End Region Image Formula C & E Tablet 150 unit Oral Abundance Naturally Ltd 1998-01-05 2006-06-16 Canada - Mixture Products
-
Name Ingredients Dosage Route Labeller Marketing Start Marketing End Region Image Cotazym Pancrelipase lipase(10000 units)+Pancrelipase amylase(40000 units)+Pancrelipase protease(35000 units) Capsule Oral Organon Canada Inc. 1973-12-31 Not applicable Canada Cotazym Ecs 20 Pancrelipase lipase(25000 units)+Pancrelipase amylase(100000 units)+Pancrelipase protease(100000 units) Capsule, delayed release Oral Organon Canada Inc. 1989-12-31 Not applicable Canada Cotazym Ecs 4 Pancrelipase lipase(4000 unit)+Pancrelipase amylase(11000 unit)+Pancrelipase protease(11000 unit) Capsule Oral Merck Ltd. 1997-08-18 2012-01-23 Canada Cotazym Ecs 8 Pancrelipase lipase(10800 units)+Pancrelipase amylase(42000 units)+Pancrelipase protease(45000 units) Capsule, delayed release Oral Organon Canada Inc. 1980-12-31 Not applicable Canada Creon Pancrelipase lipase(3000 [USP'U]/1)+Pancrelipase amylase(15000 [USP'U]/1)+Pancrelipase protease(9500 [USP'U]/1) Capsule, delayed release Oral AbbVie Inc. 2009-04-30 Not applicable US Creon Pancrelipase lipase(12000 [USP'U]/1)+Pancrelipase amylase(60000 [USP'U]/1)+Pancrelipase protease(38000 [USP'U]/1) Capsule, delayed release pellets Oral 医生总保健公司. 2009-09-29 Not applicable US Creon Pancrelipase lipase(6000 [USP'U]/1)+Pancrelipase amylase(30000 [USP'U]/1)+Pancrelipase protease(19000 [USP'U]/1) Capsule, delayed release pellets Oral AbbVie Inc. 2009-04-30 Not applicable US Creon Pancrelipase lipase(24000 [USP'U]/1)+Pancrelipase amylase(120000 [USP'U]/1)+Pancrelipase protease(76000 [USP'U]/1) Capsule, delayed release pellets Oral AbbVie Inc. 2009-04-30 Not applicable US Creon Pancrelipase lipase(12000 [USP'U]/1)+Pancrelipase amylase(60000 [USP'U]/1)+Pancrelipase protease(38000 [USP'U]/1) Capsule, delayed release pellets Oral Atlantic Biologicals Corps. 2010-08-13 Not applicable US Creon Pancrelipase lipase(36000 [USP'U]/1)+Pancrelipase amylase(180000 [USP'U]/1)+Pancrelipase protease(114000 [USP'U]/1) Capsule, delayed release pellets Oral AbbVie Inc. 2013-03-14 Not applicable US - Unapproved/Other Products
-
Name Ingredients Dosage Route Labeller Marketing Start Marketing End Region Image Creon 10 Minimicrospheres Pancrelipase lipase(10000 [USP'U]/1)+Pancrelipase amylase(33200 [USP'U]/1)+Pancrelipase protease(37500 [USP'U]/1) Capsule, delayed release Oral 医生总保健公司. 2006-09-12 2009-09-30 US Creon 20 Minimicrospheres Pancrelipase lipase(20000 [USP'U]/1)+Pancrelipase amylase(66400 [USP'U]/1)+Pancrelipase protease(75000 [USP'U]/1) Capsule, delayed release Oral 医生总保健公司. 1995-01-17 2009-09-30 US Pancrelipase Pancrelipase lipase(20000 [USP'U]/1)+Pancrelipase amylase(56000 [USP'U]/1)+Pancrelipase protease(44000 [USP'U]/1) Capsule, delayed release Oral Kaiser Foundations Hospitals 2010-02-01 2010-12-31 US
Categories
- Drug Categories
- Chemical TaxonomyProvided byClassyfire
-
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
- Affected organisms
-
- Humans and other mammals
Chemical Identifiers
- UNII
- 8MYC33932O
- CAS number
- 9001-62-1
参考文献
- 一般References
-
- Chapus C, Rovery M, Sarda L, Verger R: Minireview on pancreatic lipase and colipase. Biochimie. 1988 Sep;70(9):1223-34. [Article]
- Chapus C, Semeriva M, Bovier-Lapierre C, Desnuelle P: Mechanism of pancreatic lipase action. 1. Interfacial activation of pancreatic lipase. Biochemistry. 1976 Nov 16;15(23):4980-7. [Article]
- Creon monograph [Link]
- FDA approval [Link]
- External Links
-
- PubChem Substance
- 347911431
- 1427018
- Wikipedia
- Pancreatic_lipase_family
- FDA label
-
Download (483 KB)
- MSDS
-
Download (62.3 KB)
Clinical Trials
- Clinical TrialsLearn More" title="" id="clinical-trials-info" class="drug-info-popup" href="javascript:void(0);">
-
Phase Status Purpose Conditions Count 4 Active Not Recruiting Treatment Cystic Fibrosis (CF)/Pancreatitis, Chronic 1 4 Completed Treatment Cystic Fibrosis (CF) 1 4 Completed Treatment Cystic Fibrosis (CF)/Exocrine Pancreatic Insufficiency 2 4 Completed Treatment Exocrine Pancreatic Insufficiency/Pancreatitis, Chronic 1 4 Completed Treatment Pancreatic Insufficiency 1 4 Completed Treatment Pancreatitis, Chronic 1 4 Terminated Treatment Exocrine Pancreatic Insufficiency 1 4 Terminated Treatment Patients With Coeliac Disease and Chronic Diarrhoea (>3 Loose/ Liquid Motions a Day for More Than 4 Weeks)/Patients With Pancreatic Exocrine Insufficiency 1 4 Withdrawn Treatment Exocrine Pancreatic Insufficiency 1 4 Withdrawn Treatment Exocrine Pancreatic Insufficiency in Subjects With Diabetes Mellitus Type 2 1
Pharmacoeconomics
- Manufacturers
-
Not Available
- Packagers
-
Not Available
- Dosage Forms
-
Form Route Strength Capsule, delayed release pellets Oral Capsule, delayed release Oral Capsule, delayed release pellets Not applicable Capsule, delayed release pellets Granule, delayed release Oral Capsule Oral Tablet, coated Oral Capsule, coated pellets Oral Tablet Oral 150 unit Capsule, extended release Oral Capsule, coated Oral 22500 U Ph.Eu Tablet Oral Powder Oral - Prices
- Not Available
- Patents
-
Patent Number Pediatric Extension Approved Expires (estimated) Region US9198871 No 2015-12-01 2030-02-07 US US8562979 No 2013-10-22 2028-02-20 US US8562980 No 2013-10-22 2028-02-20 US US8562981 No 2013-10-22 2028-02-20 US US8221747 No 2012-07-17 2028-02-20 US US8562978 No 2013-10-22 2028-02-20 US US8246950 No 2012-08-21 2028-02-20 US US7658918 No 2010-02-09 2028-02-20 US
Properties
- State
- Solid
- Experimental Properties
-
Property Value Source water solubility Slightly soluble 'MSDS' isoelectric point 7.4 Iizuka K. et al. 1991. Ann clin Biochem.
Targets
insights and accelerate drug research.
参考文献
- Chapus C, Semeriva M, Bovier-Lapierre C, Desnuelle P: Mechanism of pancreatic lipase action. 1. Interfacial activation of pancreatic lipase. Biochemistry. 1976 Nov 16;15(23):4980-7. [Article]
Drug created at November 16, 2016 15:28 / Updated at April 30, 2023 03:04