Pancrelipase protease
Identification
- Summary
-
Pancrelipase proteaseis a lipase used to treat pancreatic exocrine insufficiency.
- Brand Names
-
Cotazym, Creon, Pancrease MT, Pancreaze, Pertzye, Viokace, Zenpep
- Generic Name
- Pancrelipase protease
- DrugBank Accession Number
- DB11066
- Background
-
Pancrelipase, in general, is composed of a mixture of pancreatic enzymes which include amylases, lipases, and proteases. These enzymes are extracted from porcine pancreatic glands.2The pancrelipase protease is a mix of enzymes, formed by trypsin and chymotrypsin, that proteolytically cleave peptide bonds and are involved in food digestion.1,4The pancrelipase mixture, including pancrelipase protease, was developed by Ortho-McNeil-Janssen Pharmaceuticals, Inc and FDA approved on April 12, 2010.3
- Type
- Biotech
- Groups
- Approved
- Biologic Classification
-
Protein Based Therapies
其他protein based therapies - Protein Chemical Formula
- Not Available
- 蛋白质断言age Weight
- Not Available
- Sequences
-
>sp|P00761|TRYP_PIG Trypsin OS=Sus scrofa OX=9823 PE=1 SV=1 FPTDDDDKIVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGE HNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAA GTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDS CQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
>AEC11098.1 chymotrypsin C [Sus scrofa] MLGITVLAALLAYASSCGVPSFPPNLSARVVGGENAVPHSWPWQISLQYLSGDTWKHTCG GTLITSTHVLTAAHCISNSRTYRVALGKNNLEVEDEEGSLVVGVDSIFVHEKWNSLLIRN DIALIKLAEPVELSDTIQVLCLPEEGSLLPQDYPCYVTGWGRLWTNGPIAAELQQGLQPV VDHATCSQRDWWGSTVRDTMVCAGGDGVISACNGDSGGPLNCQAENGSWEVRGIVSFGSG LGCNTYKKPTVFTRVSAYIDWIDQKIQL
Download FASTA Format - Synonyms
-
- Protease, pancreatic
Pharmacology
- Indication
-
Please refer toPancrelipase.
Reduce drug development failure ratesBuild, train, & validate machine-learning models
with evidence-based and structured datasets.Build, train, & validate predictive machine-learning models with structured datasets. - Associated Conditions
- Contraindications & Blackbox Warnings
-
Avoid life-threatening adverse drug eventsImprove clinical decision support with information oncontraindications & blackbox warnings, population restrictions, harmful risks, & more.Avoid life-threatening adverse drug events & improve clinical decision support.
- Pharmacodynamics
-
Please refer toPancrelipase.
- Mechanism of action
-
Pancrelipase protease acts on the peptide bonds within the proteins. The two constituents of the pancrelipase protease, trypsin, and chymotrypsin, are grouped under the family of serine proteases. Trypsin acts on lysine and arginine residues while chymotrypsin acts in hydrophobic residues such as tryptophan, tyrosine and phenylalanine. Both constituents present a catalytic site in the S1 binding pocket formed by a triad of serine, histidine and aspartate.5
Target Actions Organism ADietary protein cleavageHumans - Absorption
-
Please refer toPancrelipase.
- Volume of distribution
-
Please refer toPancrelipase.
- Protein binding
-
Please refer toPancrelipase.
- Metabolism
-
Please refer toPancrelipase.
- Route of elimination
-
Please refer toPancrelipase.
- Half-life
-
Please refer toPancrelipase.
- Clearance
-
Please refer toPancrelipase.
- Adverse Effects
-
Improve decision support & research outcomesWith structured adverse effects data, including:blackbox warnings, adverse reactions, warning & precautions, & incidence rates.Improve decision support & research outcomes with our structured adverse effects data.
- Toxicity
-
Please refer toPancrelipase.
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRsBrowse all" title="" id="snp-actions-info" class="drug-info-popup" href="javascript:void(0);">
- Not Available
Interactions
- Drug InteractionsLearn More" title="" id="structured-interactions-info" class="drug-info-popup" href="javascript:void(0);">
-
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.Not Available
- Food Interactions
-
- Take with food.
Products
-
Drug product information from 10+ global regionsOur datasets provide approved product information including:
dosage, form, labeller, route of administration, and marketing period.Access drug product information from over 10 global regions. - Product Images
-
- Mixture Products
-
Name Ingredients Dosage Route Labeller Marketing Start Marketing End Region Image Cotazym Pancrelipase protease(35000 units)+Pancrelipase amylase(40000 units)+Pancrelipase lipase(10000 units) Capsule Oral Organon Canada Inc. 1973-12-31 Not applicable Canada Cotazym Ecs 20 Pancrelipase protease(100000 units)+Pancrelipase amylase(100000 units)+Pancrelipase lipase(25000 units) Capsule, delayed release Oral Organon Canada Inc. 1989-12-31 Not applicable Canada Cotazym Ecs 4 Pancrelipase protease(11000 unit)+Pancrelipase amylase(11000 unit)+Pancrelipase lipase(4000 unit) Capsule Oral Merck Ltd. 1997-08-18 2012-01-23 Canada Cotazym Ecs 8 Pancrelipase protease(45000 units)+Pancrelipase amylase(42000 units)+Pancrelipase lipase(10800 units) Capsule, delayed release Oral Organon Canada Inc. 1980-12-31 Not applicable Canada Creon Pancrelipase protease(38000 [USP'U]/1)+Pancrelipase amylase(60000 [USP'U]/1)+Pancrelipase lipase(12000 [USP'U]/1) Capsule, delayed release pellets Oral Atlantic Biologicals Corps. 2010-08-13 Not applicable US Creon Pancrelipase protease(9500 [USP'U]/1)+Pancrelipase amylase(15000 [USP'U]/1)+Pancrelipase lipase(3000 [USP'U]/1) Capsule, delayed release Oral AbbVie Inc. 2009-04-30 Not applicable US Creon Pancrelipase protease(19000 [USP'U]/1)+Pancrelipase amylase(30000 [USP'U]/1)+Pancrelipase lipase(6000 [USP'U]/1) Capsule, delayed release pellets Oral AbbVie Inc. 2009-04-30 Not applicable US Creon Pancrelipase protease(76000 [USP'U]/1)+Pancrelipase amylase(120000 [USP'U]/1)+Pancrelipase lipase(24000 [USP'U]/1) Capsule, delayed release pellets Oral Atlantic Biologicals Corps. 2010-08-13 Not applicable US Creon Pancrelipase protease(19000 [USP'U]/1)+Pancrelipase amylase(30000 [USP'U]/1)+Pancrelipase lipase(6000 [USP'U]/1) Capsule, delayed release pellets Oral Atlantic Biologicals Corps. 2010-08-13 Not applicable US Creon Pancrelipase protease(76000 [USP'U]/1)+Pancrelipase amylase(120000 [USP'U]/1)+Pancrelipase lipase(24000 [USP'U]/1) Capsule, delayed release pellets Oral AbbVie Inc. 2009-04-30 Not applicable US - Unapproved/Other Products
-
Name Ingredients Dosage Route Labeller Marketing Start Marketing End Region Image Creon 10 Minimicrospheres Pancrelipase protease(37500 [USP'U]/1)+Pancrelipase amylase(33200 [USP'U]/1)+Pancrelipase lipase(10000 [USP'U]/1) Capsule, delayed release Oral Physicians Total Care, Inc. 2006-09-12 2009-09-30 US Creon 20 Minimicrospheres Pancrelipase protease(75000 [USP'U]/1)+Pancrelipase amylase(66400 [USP'U]/1)+Pancrelipase lipase(20000 [USP'U]/1) Capsule, delayed release Oral Physicians Total Care, Inc. 1995-01-17 2009-09-30 US Pancrelipase Pancrelipase protease(44000 [USP'U]/1)+Pancrelipase amylase(56000 [USP'U]/1)+Pancrelipase lipase(20000 [USP'U]/1) Capsule, delayed release Oral Kaiser Foundations Hospitals 2010-02-01 2010-12-31 US
Categories
- Drug Categories
- Chemical TaxonomyProvided byClassyfire
-
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
- Affected organisms
-
- Humans and other mammals
Chemical Identifiers
- UNII
- 3560D81V50
- CAS number
- 9001-94-9
References
- General References
-
- Schauperl M, Fuchs JE, Waldner BJ, Huber RG, Kramer C, Liedl KR: Characterizing Protease Specificity: How Many Substrates Do We Need? PLoS One. 2015 Nov 11;10(11):e0142658. doi: 10.1371/journal.pone.0142658. eCollection 2015. [Article]
- Creon monograph [Link]
- FDA approval [Link]
- VIVO pathophysiology [Link]
- EMBL-EBI [Link]
- External Links
- FDA label
-
Download (483 KB)
Clinical Trials
- Clinical TrialsLearn More" title="" id="clinical-trials-info" class="drug-info-popup" href="javascript:void(0);">
-
Phase Status Purpose Conditions Count 4 Active Not Recruiting Treatment Cystic Fibrosis (CF)/Pancreatitis, Chronic 1 4 Completed Not Available Human Immunodeficiency Virus (HIV) Infections/蛋白尿 1 4 Completed 其他 Coinfection, HIV/Hepatitis C Virus (HCV) Infection 1 4 Completed Treatment Cystic Fibrosis (CF) 1 4 Completed Treatment Cystic Fibrosis (CF)/Exocrine Pancreatic Insufficiency 2 4 Completed Treatment HIV Lipodystrophy Syndrome 1 4 Completed Treatment Human Immunodeficiency Virus (HIV) Infections 1 4 Completed Treatment Human Immunodeficiency Virus Type 1 (HIV-1) 1 4 Completed Treatment Human Immunodeficiency Virus Type 1 (HIV-1) Infection 1 4 Completed Treatment Pancreatic Insufficiency 1
Pharmacoeconomics
- Manufacturers
-
Not Available
- Packagers
-
Not Available
- Dosage Forms
-
Form Route Strength Capsule, delayed release pellets Oral Capsule, delayed release Oral Capsule, delayed release pellets Not applicable Capsule, delayed release pellets Granule, delayed release Oral Capsule Oral Tablet, coated Oral Capsule, coated pellets Oral Capsule, extended release Oral Capsule, coated Oral 22500 U Ph.Eu Tablet Oral Powder Oral - Prices
- Not Available
- Patents
-
Patent Number Pediatric Extension Approved Expires (estimated) Region US9198871 No 2015-12-01 2030-02-07 US US8562979 No 2013-10-22 2028-02-20 US US8562980 No 2013-10-22 2028-02-20 US US8562981 No 2013-10-22 2028-02-20 US US8221747 No 2012-07-17 2028-02-20 US US8562978 No 2013-10-22 2028-02-20 US US8246950 No 2012-08-21 2028-02-20 US US7658918 No 2010-02-09 2028-02-20 US
Properties
- State
- Solid
- Experimental Properties
-
Property Value Source water solubility 1 mg/ml Monograph
Targets
Drug created at December 03, 2015 16:51 / Updated at May 21, 2021 10:21